50 Best Jane Austen Blogs and Websites

Follow Top 50 Jane Austen Blogs from one place on Feedspot Reader
The best Jane Austen blogs from thousands of Book blogs on the web and ranked by traffic, social media followers & freshness.

Jane Austen Blogs

Here are 50 Best Jane Austen Blogs you should follow in 2024

1. Austenprose

Austenprose Join the celebration of Jane Austen novels, movies, sequels and the pop culture she has inspired
austenprose.com
Facebook Followers 5.4KTwitter Followers 10.3KInstagram Followers 2.4K Frequency 1 post / week Domain Authority 52 Get Email Contact Get Influential Bloggers ContactsGet access to 250k active Bloggers, Podcasters, YouTubers, and Instagram Influencers in 1500 niche categories.Get targeted media contact list in your niche at your fingertips so you can focus on running your campaign.Email us the type of bloggers you want to reach out for your marketing campaign at anuj@feedspot.com Copy email. We'll share blogger's data in an Excel or CSV format.

2. Austenesque Reviews

Austenesque Reviews austenesquereviews.com
Twitter Followers 2K Frequency 4 posts / week Domain Authority 31 Get Email Contact

3. Jane Austen Variations

Jane Austen Variations austenvariations.com
Twitter Followers 1.7K Frequency 1 post / week Domain Authority 36 more » Get Email Contact

4. The Jane Austen Blog

The Jane Austen Blog janeausten.co.uk
Facebook Followers 130.1KTwitter Followers 20.9K Frequency 1 post / week Domain Authority 65 more » Get Email Contact

5. Jane Austen's House

Jane Austen's House The most treasured Austen site in the world
janeaustens.house
Facebook Followers 35.1KTwitter Followers 20.9K Frequency 3 posts / month Domain Authority 59 more » Get Email Contact

6. Literary Hub » Jane Austen

Literary Hub » Jane Austen The best of the literary web
lithub.com
Facebook Followers 263.5KTwitter Followers 301.9KInstagram Followers 222.1K Frequency 9 posts / year Domain Authority 76 more » Get Email Contact

7. My Jane Austen Book Club

My Jane Austen Book Club A friendly meeting place to read and discuss anything Austen...
thesecretunderstandingofthehearts.blogspot.com
Facebook Followers 83.3KTwitter Followers 6.1K Frequency 2 posts / month Domain Authority 37 more » Get Email Contact

8. Jane Austen Addict

Jane Austen Addict Laurie Viera Rigler, author of the 'Jane Austen Addict' series and other time-bending tales
janeaustenaddict.com
Twitter Followers 3.6K Frequency 1 post / day Domain Authority 33 more » Get Email Contact

9. Always Austen Blog

Always Austen Blog Celebrating Jane Austen's Enduring Legacy
alwaysausten.com
Twitter Followers 4.9K Frequency 4 posts / week Domain Authority 8 more » Get Email Contact

10. Chawton House

Chawton House Known to Jane Austen as 'the Great House'
chawtonhouse.org
Facebook Followers 12.5KTwitter Followers 11.4K Frequency 1 post / quarter Domain Authority 49 more » Get Email Contact

11. Jane Austen Summer Program

Jane Austen Summer Program JASP
janeaustensummer.org
Facebook Followers 1.5KTwitter Followers 1.4K Frequency 1 post / day Domain Authority 27 more » Get Email Contact

12. Jane Austen Society of North America

Jane Austen Society of North America jasna.org
Facebook Followers 17.1KTwitter Followers 1.4K Frequency 1 post / week Domain Authority 58 more » Get Email Contact

13. Every Woman Dreams… » Jane Austen

Every Woman Dreams… » Jane Austen Regina Jeffers, Author
reginajeffers.blog
Twitter Followers 4.9K Frequency 2 posts / week Domain Authority 48 more » Get Email Contact

14. Shannon Winslow's 'Jane Austen Says…'

Shannon Winslow's 'Jane Austen Says…' the official website & blog of author Shannon Winslow
shannonwinslow.com
Twitter Followers 1.4K Frequency 2 posts / quarter Domain Authority 24 more » Get Email Contact

15. From Pemberley to Milton

From Pemberley to Milton frompemberleytomilton.wordpress.com
Twitter Followers 345 Frequency 2 posts / day Domain Authority 29 more » Get Email Contact

16. Lona Manning Blog

Lona Manning Blog Blog
lonamanning.ca
Facebook Followers 135Twitter Followers 568 Frequency 4 posts / month Domain Authority 19 more » Get Email Contact

17. Jane Austen Runs My Life

Jane Austen Runs My Life A topnotch WordPress.com site
janeaustenrunsmylife.wordpress.com
Facebook Followers 1.3KTwitter Followers 305 Frequency 1 post / day Domain Authority 35 more » Get Email Contact

18. Deborah Yaffe Blog

Deborah Yaffe Blog DeborahYaffe.com
deborahyaffe.com
Facebook Followers 592Twitter Followers 690 Frequency 1 post / week Domain Authority 24 more » Get Email Contact

19. The Fiction Addiction » Janeite Reinventions

The Fiction Addiction » Janeite Reinventions Book reviews with all the feelings
thefictionaddiction.com
Facebook Followers 1.9KTwitter Followers 4.8KInstagram Followers 10.9K Frequency 1 post / month Domain Authority 29 more » Get Email Contact

20. Strictly Jane Austen Tours Blog

Strictly Jane Austen Tours Blog Strictly Jane Austen Step back into Regency England on our Strictly Jane Austen tours
strictlyjaneausten.com
Facebook Followers 3.1KTwitter Followers 1.8K Frequency 1 post / month Domain Authority 23 more » Get Email Contact

21. Sarah Emsley » Jane Austen

Sarah Emsley » Jane Austen writer & editor
sarahemsley.com
Twitter Followers 1.5K Frequency 1 post / month Domain Authority 37 more » Get Email Contact

22. Dr Lizzie Rogers » Jane Austen

Dr Lizzie Rogers » Jane Austen Historian of the Eighteenth & early Nineteenth Centuries
historylizzie.co.uk
Facebook Followers 286Twitter Followers 3.7K Frequency 2 posts / quarter Domain Authority 16 more » Get Email Contact

23. Jane Austen Literacy Foundation

Jane Austen Literacy Foundation janeaustenlf.org
Facebook Followers 12.6KTwitter Followers 1.3K Frequency 9 posts / quarter Domain Authority 34 more » Get Email Contact

24. Rachel Dodge » Jane Austen

Rachel Dodge » Jane Austen Kindred Spirit. Saved By Grace.
racheldodge.com
Facebook Followers 1.3KTwitter Followers 1.5K Frequency 1 post / quarter Domain Authority 24 more » Get Email Contact

25. Quickstep Travel Guide

Quickstep Travel Guide For Jane Austen fans who want to follow in Jane's footsteps and have fun doing it!
janeaustenquickstepguide.com
Twitter Followers 563 Frequency 1 post / quarter Domain Authority 8 more » Get Email Contact

26. Susannah Fullerton » Jane Austen

Susannah Fullerton » Jane Austen Literary Historian, Lecturer & Tour Leader
susannahfullerton.com.au
Facebook Followers 915Twitter Followers 158 Frequency 2 posts / year Domain Authority 32 more » Get Email Contact

27. The Calico Critic

The Calico Critic Reviewing and giving away a bit of this and that, in the low-key calico style since 2009.
calicocritic.blogspot.com
Frequency 2 posts / month Domain Authority 27 more » Get Email Contact

28. The Jane Austen Project: A Novel Blog

The Jane Austen Project: A Novel Blog What Would You Give Up So She Could Live?
thejaneaustenproject.com
Twitter Followers 1.1K Frequency 1 post / week Domain Authority 28 more » Get Email Contact

29. Jane Austen Society of North America New Jersey Region Blog

Jane Austen Society of North America New Jersey Region Blog jasnanj.com/blog
Facebook Followers 473Twitter Followers 1.5K Frequency 1 post / month Domain Authority 12 more » Get Email Contact

30. My Vices and Weaknesses » Jane Austen

My Vices and Weaknesses » Jane Austen 'Reading one book is like eating one potato chip' (Diane Duane)
myvicesandweaknesses.wordpress.com
Facebook Followers 900Twitter Followers 277 Frequency 2 posts / month Domain Authority 25 more » Get Email Contact

31. Reveries Under the Sign of Austen, Two

Reveries Under the Sign of Austen, Two 'It is well to have as many holds upon happiness as possible' -- Henry Tilney, NA: a blog on Austen, 18th century & Women's Art
reveriesunderthesignofausten.wordpress.com
Frequency 2 posts / month Domain Authority 32 more » Get Email Contact

32. Jane Austen in Vermont

Jane Austen in Vermont From the timeless themes of love and marriage to the hilarious quirks of her characters, Austen's work offers a treasure trove for both the casual reader and the literature enthusiast. Prepare for lively discussions, random musings, and perhaps a touch of gossip, all inspired by the master of Regency romance.
janeausteninvermont.blog
Frequency 4 posts / quarter Domain Authority 23 more » Get Email Contact

33. Jane Austen Reviews

Jane Austen Reviews Reviews on all things Austen
janeaustenreviews.com
Frequency 1 post / month Domain Authority 11 more » Get Email Contact

34. Rose Fairbanks » Jane Austen

Rose Fairbanks » Jane Austen Positive, Encouraging Romance
rosefairbanks.com
Facebook Followers 732 Frequency 2 posts / quarter Domain Authority 18 more » Get Email Contact

35. A Lady's Imagination

A Lady's Imagination Various postings on my Austenesque stories, and the Georgian and Regency eras.
sophie-turner-acl.blogspot.com
Facebook Followers 595Twitter Followers 464 Frequency 10 posts / year Domain Authority 21 more » Get Email Contact

36. Two Teens in the Time of Austen

Two Teens in the Time of Austen (Re)Connect with the Regency
smithandgosling.wordpress.com
Facebook Followers 6 Frequency 2 posts / quarter Domain Authority 27 more » Get Email Contact

37. Jane Austen's World

Jane Austen's World This Jane Austen blog brings Jane Austen, her novels, and the Regency Period alive through food, dress, social customs, and other 19th C. historical details related to this topic. Step into the Regency era in these pages where scandal simmers in drawing rooms and romance blossoms under gaslight.
janeaustensworld.com
Facebook Followers 197Twitter Followers 3.7KInstagram Followers 2.8K Frequency 1 post / week Domain Authority 1 more » Get Email Contact

38. JASACT - Jane Austen and all that in Canberra

JASACT - Jane Austen and all that in Canberra Jane Austen and all that - in Canberra
jasact.wordpress.com
Frequency 2 posts / quarter Domain Authority 13 more » Get Email Contact

39. Sheila Johnson Kindred

Sheila Johnson Kindred Sheila Johnson Kindred's blog explores Jane Austen's naval world.
sheilajohnsonkindred.com
Frequency 1 post / quarter Domain Authority 11 more » Get Email Contact

40. JASNA Central and Western New York

JASNA Central and Western New York Based in Rochester, NY - Covering Central NY, Western NY, North Country NY, Mohawk Valley NY & Southern Tier NY with members in Rochester, Buffalo, Syracuse, Binghamton and Utica areas.
jasnacwny.blogspot.com
Frequency 1 post / week Domain Authority 7 more » Get Email Contact

41. Roses and Reviews » Jane Austen

Roses and Reviews » Jane Austen rosesandreviews.blog
Frequency 1 post / month Domain Authority 5 more » Get Email Contact

42. Faith, Science, Joy, and Jane Austen

Faith, Science, Joy, and Jane Austen Home of Topaz Cross Books, Brenda S. Cox
topazcrossbooks.com
Facebook Followers 213 Frequency 1 post / month Domain Authority 2 more » Get Email Contact

43. JASNA Hawai'i Blog

JASNA Hawai'i Blog jasnahawaii.org
Frequency 2 posts / quarter Domain Authority 6 more » Get Email Contact

44. Syrie James Blog

Syrie James Blog Author
syriejames.com
Facebook Followers 1.5KTwitter Followers 2.8K Frequency 1 post / quarter Domain Authority 34 more » Get Email Contact

45. Katherine Cowley » Jane Austen Writing Lessons

Katherine Cowley » Jane Austen Writing Lessons author and teacher
katherinecowley.com
Facebook Followers 688Twitter Followers 1.1K Frequency 3 posts / year Domain Authority 33 more » Get Email Contact

46. The Scribblings of Alexa Adams

The Scribblings of Alexa Adams alexaadams.blogspot.com
Facebook Followers 579Twitter Followers 1.2K Frequency 9 posts / year Domain Authority 20 more » Get Email Contact

47. Austenised

Austenised Step into the early 1800s regal charm with intricate observations of historical sites, artifacts, and books. Austenised is a blog about Jane Austen, life, literature, the Regency period, and lifestyle. Contains historical information about Jane Austen and her family, and friends.
austenised.blogspot.com
Frequency 1 post / year Domain Authority 23 more » Get Email Contact

48. The Pemberley Podcast Blog

The Pemberley Podcast Blog A Jane Austen Podcast discussing film, TV, and book adaptations
thepemberleypodcast.wordpress.com
Facebook Followers 882Twitter Followers 708 Frequency 3 posts / year Domain Authority 17 more » Get Email Contact

49. A.M. Pine Hearth Ridge Reflections » Jane Austen

A.M. Pine Hearth Ridge Reflections » Jane Austen Ramblings of Heart & Home
ampine-hearthridgereflections.com
Facebook Followers 200Twitter Followers 155 Frequency 5 posts / year Domain Authority 11 more » Get Email Contact

50. Babblings of a Bookworm

Babblings of a Bookworm A book blog which mostly features books about or inspired by Jane Austen.
babblingsofabookworm.blogspot.com
Facebook Followers 78 Frequency 12 posts / year Domain Authority 28 more » Get Email Contact

Show 50 to 183

Jane Austen Bloggers

Top Authors, Journalists, and Publishers covering Jane Austen. Get Spreadsheet
Blogger NameEmailBlog LinkTotal Blog Posts
Meredithaustenesquereviews.com82
Annaaustenised.blogspot.com24
Rita Deodatofrompemberleytomilton.wordpress.com23
L.janeaustenrunsmylife.wordpress.com19
Deborah Yaffedeborahyaffe.com19
Laurel Ann Nattressaustenprose.com11
Sarah Hurleyjaneaustensummer.org9
Lucy Marinaustenvariations.com9
Christina Morlandaustenvariations.com9
Nicole Clarkstonaustenvariations.com8
Diana Birchallaustenvariations.com8
Maria Graziathesecretunderstandingofthehearts.blogspot.com7
Regina Jeffersreginajeffers.blog6
Rachel Dodgejaneaustensworld.com6
Sophie Reynoldsjaneaustens.house6
L.L Diamondaustenvariations.com6
Shannon Winslowaustenvariations.com6
BookLady Debjaneausteninvermont.blog5
Brenda S Coxjaneaustensworld.com5
Maizie Fergusonjaneaustensummer.org4
Flynnthejaneaustenproject.com4
Mindy Harrisjaneaustensummer.org4
Jayda Justusaustenprose.com4
anadarcymyvicesandweaknesses.wordpress.com4
Abigail Reynoldsaustenvariations.com4
Anngela Schroederaustenvariations.com4
Jack Caldwellaustenvariations.com4
Monica Fairviewaustenvariations.com4
Don Jacobsonalwaysausten.com3
elaineowenauthor207097889alwaysausten.com3
Gianna Thomasalwaysausten.com3
kimbelle1alwaysausten.com3
Kirstin Odegaardalwaysausten.com3
Riana Everlyalwaysausten.com3
Tiffany Thomasalwaysausten.com3
Sarah Emsleysarahemsley.com3
Ruby Newsstrictlyjaneausten.com3
historylizziehistorylizzie.co.uk3
ellenandjimreveriesunderthesignofausten.wordpress.com3
Author Cherith Boardmanalwaysausten.com3
Maria Graceaustenvariations.com3
Katie Jacksonaustenprose.com3
Laura Hartnesscalicocritic.blogspot.com3
Corrie Garrettalwaysausten.com3
Anne Madisonalwaysausten.com3
Amanda Kaialwaysausten.com3
AAmelia Hharvelljaneaustens.house2
Kara Louiseaustenvariations.com2
Joana Starnesaustenvariations.com2
Char Jonesaustenprose.com2
Load 51 to 100 of 183 Bloggers